Loading...
Statistics
Advertisement

Flisterz | Insurance Information
www.flisterz.com/

Flisterz.com

Advertisement
Conversion Technology Metas Server
Flisterz.com is hosted in Australia / Sydney . Flisterz.com doesn't use HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Font Awesome, Html, Number of used javascripts: 4. First javascripts: Jquery.js, Jquery-migrate.min.js, Menu.js, Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5. Its CMS is: Wordpress.

Technologies in use by Flisterz.com

Technology

Number of occurences: 8
  • CSS
  • Font Awesome
  • Html
  • Html5
  • Javascript
  • jQuery
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 4
  • jquery.js
  • jquery-migrate.min.js
  • menu.js
  • bootstrap.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • Microsoft-IIS/7.5

Powered by

  • PHP/5.4.24

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Flisterz.com

Missing HTTPS protocol.

    Meta - Flisterz.com

    Number of occurences: 3
    • Name: viewport
      Content: width=device-width, initial-scale=1.0
    • Name:
      Content: Flisterz
    • Name: generator
      Content: WordPress 3.8.1

    Server / Hosting

    • IP: 54.79.31.90
    • Latitude: -33.86
    • Longitude: 151.20
    • Country: Australia
    • City: Sydney

    Rname

    • dns5.name-services.com
    • dns3.name-services.com
    • dns1.name-services.com
    • dns4.name-services.com
    • dns2.name-services.com

    Target

    • info.name-services.com

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Content-Length: 147 Content-Type: text/html; charset=UTF-8 Location: http://www.flisterz.com/ Server: Microsoft-IIS/7.5 X-Powered-By: PHP/5.4.24 Set-Cookie: wfvt_-485505530=5720708e79236; expires=Wed, 27-Apr-2016 08:25:58 GMT; path=/; httponly X-Pingback: http://www.flisterz.com/xmlrpc.php X-Powered-By: ASP.NET Date: Wed, 27 Apr 2016 07:55:58 GMT HTTP/1.1 200 OK Content-Length: 0 Content-Type: text/html; charset=UTF-8 Server: Microsoft-IIS/7.5 X-Powered-By: PHP/5.4.24 Set-Cookie: wfvt_-485505530=5720709043074; expires=Wed, 27-Apr-2016 08:26:00 GMT; path=/; httponly X-Pingback: http://www.flisterz.com/xmlrpc.php X-Powered-By: ASP.NET Date: Wed, 27 Apr 2016 07:56:01 GMT

    DNS

    host: flisterz.com
    1. class: IN
    2. ttl: 1800
    3. type: A
    4. ip: 54.79.31.90
    host: flisterz.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns5.name-services.com
    host: flisterz.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns3.name-services.com
    host: flisterz.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns1.name-services.com
    host: flisterz.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns4.name-services.com
    host: flisterz.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns2.name-services.com
    host: flisterz.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: dns1.name-services.com
    5. rname: info.name-services.com
    6. serial: 1446774243
    7. refresh: 172800
    8. retry: 900
    9. expire: 1814400
    10. minimum-ttl: 3600

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.listerz.com, www.fqlisterz.com, www.qlisterz.com, www.flisterz.com, www.listerz.com, www.falisterz.com, www.alisterz.com, www.fylisterz.com, www.ylisterz.com, www.ftlisterz.com, www.tlisterz.com, www.fglisterz.com, www.glisterz.com, www.fblisterz.com, www.blisterz.com, www.fwlisterz.com, www.wlisterz.com, www.fslisterz.com, www.slisterz.com, www.fdlisterz.com, www.dlisterz.com, www.frlisterz.com, www.rlisterz.com, www.f3listerz.com, www.3listerz.com, www.f4listerz.com, www.4listerz.com, www.fisterz.com, www.fluisterz.com, www.fuisterz.com, www.fl8isterz.com, www.f8isterz.com, www.fl9isterz.com, www.f9isterz.com, www.fljisterz.com, www.fjisterz.com, www.fl0isterz.com, www.f0isterz.com, www.flmisterz.com, www.fmisterz.com, www.flpisterz.com, www.fpisterz.com, www.floisterz.com, www.foisterz.com, www.flsterz.com, www.flirsterz.com, www.flrsterz.com, www.flifsterz.com, www.flfsterz.com, www.flivsterz.com, www.flvsterz.com, www.fliksterz.com, www.flksterz.com, www.fli,sterz.com, www.fl,sterz.com, www.flibsterz.com, www.flbsterz.com, www.fligsterz.com, www.flgsterz.com, www.flitsterz.com, www.fltsterz.com, www.fliysterz.com, www.flysterz.com, www.fliusterz.com, www.flusterz.com, www.flijsterz.com, www.fljsterz.com, www.flimsterz.com, www.flmsterz.com, www.flinsterz.com, www.flnsterz.com, www.fliterz.com, www.fliseterz.com, www.flieterz.com, www.fliswterz.com, www.fliwterz.com, www.flisdterz.com, www.flidterz.com, www.flisxterz.com, www.flixterz.com, www.flisfterz.com, www.flifterz.com, www.flisgterz.com, www.fligterz.com, www.flistterz.com, www.flitterz.com, www.fliserz.com, www.flistqerz.com, www.flisqerz.com, www.flistaerz.com, www.flisaerz.com, www.flist erz.com, www.flis erz.com, www.flistwerz.com, www.fliswerz.com, www.flisteerz.com, www.fliseerz.com, www.flistzerz.com, www.fliszerz.com, www.flistxerz.com, www.flisxerz.com, www.flistcerz.com, www.fliscerz.com, www.flistrz.com, www.flistexrz.com, www.flistxrz.com, www.flistesrz.com, www.flistsrz.com, www.flistewrz.com, www.flistwrz.com, www.flisterrz.com, www.flistrrz.com, www.flistefrz.com, www.flistfrz.com, www.flistevrz.com, www.flistvrz.com, www.flistecrz.com, www.flistcrz.com, www.flisteqrz.com, www.flistqrz.com, www.flistearz.com, www.flistarz.com, www.flisteyrz.com, www.flistyrz.com, www.flistez.com, www.flisteriz.com, www.flisteiz.com, www.flisteroz.com, www.flisteoz.com, www.flisterlz.com, www.flistelz.com, www.flisterlz.com, www.flistelz.com, www.flister.z.com, www.fliste.z.com, www.flister.com, www.flisterzt.com, www.flistert.com, www.flisterza.com, www.flistera.com, www.flisterzs.com, www.flisters.com, www.flisterzx.com, www.flisterx.com, www.flisterzc.com, www.flisterc.com, www.flisterzg.com, www.flisterg.com, www.flisterzh.com, www.flisterh.com, www.flisterzj.com, www.flisterj.com, www.flisterzu.com, www.flisteru.com,

    Other websites we recently analyzed

    1. oneminutekent.com
      United Kingdom - 79.170.44.111
      Server software: Apache/2.4.18 (Unix)
      Technology: Html, Php, Swf Object, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 3
    2. creactioninc.com
      Scottsdale (United States) - 184.168.221.96
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    3. Keller Williams Realty Professional Partners rentals and property management - single family homes, townhomes, condos, apartments rent and lease in {merge-region}.
      Keller Williams Realty Professional Partners serves the {merge-region} area with {merge-specialization}.
      Dallas (United States) - 75.126.183.70
      Server software: Apache
      Technology: CloudFlare, CSS, Google Font API, Html, Iframe, Javascript, jQuery, jQuery UI, Google Analytics
      Number of Javascript: 6
      Number of meta tags: 3
    4. promastix.com
      Selling Insights based theme
      Lansing (United States) - 67.227.192.181
      Server software: Apache/2.4.16 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4
      Technology: CSS, Flexslider, Html, Html5, Javascript, Google Analytics
      Number of Javascript: 5
      Number of meta tags: 4
    5. 给料网-每天都免费！
      Central District (Hong Kong) - 103.27.176.52
      Server software: IIS
      Technology: Html, Php
      Number of meta tags: 1
    6. 8560.de - Diese Website steht zum Verkauf! - Informationen zum Thema 8 560.
      Diese Website steht zum Verkauf! 8560.de ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf 8560.de alles. Wir hoffen, dass Sie hier das Gesuchte finden!
      Cambridge (United States) - 72.52.4.90
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 5
    7. Charlemagne
      United Kingdom - 185.19.14.71
      Server software: Microsoft-IIS/7.5
      Technology: Carousel, CSS, Google Font API, Html, Html5, Iframe, Javascript, Google Tagmanager
      Number of Javascript: 9
      Number of meta tags: 3
    8. academiccredittransferpathway.ca
      Scottsdale (United States) - 184.168.221.46
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    9. Jich.de
      Germany - 88.198.231.9
      Server software: Apache/2.4.10 (Debian)
      Technology: CSS, Html, Html5, Javascript, jQuery
      Number of Javascript: 15
      Number of meta tags: 4
    10. nutritionnews.net
      Switzerland - 141.8.225.124
      Server software: Apache
      Technology: Html

    Check Other Websites